| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
| Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
| Domain d1fnwh2: 1fnw H:2208-2321 [37820] Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1 complexed with cd |
PDB Entry: 1fnw (more details), 3.9 Å
SCOPe Domain Sequences for d1fnwh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnwh2 d.15.6.1 (H:2208-2321) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk
Timeline for d1fnwh2: