SCOPe 2.07: Domain d6ca9a2: 6ca9 A:107-212

Lineage for d6ca9a2 (6ca9 A:107-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6ca9a2: 6ca9 A:107-212 [378179]
   Other proteins in same PDB: d6ca9a1, d6ca9c1
   automated match to d1dn0a2
   complexed with gol, peg

Details for d6ca9a2

PDB Entry: 6ca9, 2.7 Å

PDB Description: crystal structure of fab pct64_lmca (sar), the least mutated common ancestor of the hiv-1 broadly neutralizing antibody lineage pct64

PDB Compounds: (A:) PCT64_LMCA Fab light chain

SCOPe Domain Sequences for d6ca9a2:

Sequence; same for both SEQRES and ATOM records:

>d6ca9a2 b.1.1.2 (A:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d6ca9a2:

• d6ca9a2 is new in SCOPe 2.07-stable
  
• d6ca9a2 appears in the current release, SCOPe 2.08