Lineage for d6v2ma1 (6v2m A:10-227)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2527952Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2527953Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2527954Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2528047Protein automated matches [257342] (3 species)
    not a true protein
  7. 2528048Species Escherichia coli [TaxId:562] [350276] (5 PDB entries)
  8. 2528049Domain d6v2ma1: 6v2m A:10-227 [378147]
    Other proteins in same PDB: d6v2ma2
    automated match to d1os1a2
    complexed with atp, ca, mg; mutant

Details for d6v2ma1

PDB Entry: 6v2m (more details), 1.66 Å

PDB Description: structure of escherichia coli asp269asn mutant phosphoenolpyruvate carboxykinase
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6v2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v2ma1 c.109.1.1 (A:10-227) automated matches {Escherichia coli [TaxId: 562]}
eeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrspkd
kyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcganp
dtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnsen
fvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6v2ma1:

Click to download the PDB-style file with coordinates for d6v2ma1.
(The format of our PDB-style files is described here.)

Timeline for d6v2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6v2ma2