SCOPe 2.08: Domain d6kaco_: 6kac o:

Lineage for d6kaco_ (6kac o:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.0: automated matches [191664] (1 protein)
   not a true family

6. Protein automated matches [191257] (6 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [378068] (1 PDB entry)

8. Domain d6kaco_: 6kac o: [378069]
   Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kacj_, d6kack_, d6kacm_, d6kacn_, d6kacp_, d6kacs_, d6kacy_, d6kacz_
   automated match to d5xnlo_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kaco_

PDB Entry: 6kac, 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii

PDB Compounds: (o:) Oxygen-evolving enhancer protein 1, chloroplastic

SCOPe Domain Sequences for d6kaco_:

Sequence; same for both SEQRES and ATOM records:

>d6kaco_ f.4.1.0 (o:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ltfdeiqgltylqvkgsgiantcpvlesgttnlkelkagsyklenfcieptsftvkeesq
fkggetefvktklmtrltytldamsgsfkvgsdgsaelkeddgidyaattvqlpggerva
flftikqfdgkgtldgikgdflvpsyrgssfldpkgrggstgydnavalparadaeellk
envkitkalkgsavfsvakvdpvtgeiagvfesiqpsdtdlgakppkdikvtglwyaqlk

Timeline for d6kaco_:

• d6kaco_ first appeared in SCOPe 2.07