Lineage for d6kaca_ (6kac A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027502Protein automated matches [190224] (17 species)
    not a true protein
  7. 3027519Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [378058] (1 PDB entry)
  8. 3027520Domain d6kaca_: 6kac A: [378060]
    Other proteins in same PDB: d6kacb_, d6kacc_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kacj_, d6kack_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacs_, d6kacy_, d6kacz_
    automated match to d2axta1
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kaca_

PDB Entry: 6kac (more details), 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii
PDB Compounds: (A:) Photosystem II protein D1

SCOPe Domain Sequences for d6kaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kaca_ f.26.1.1 (A:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ensslwarfcewitstenrlyigwfgvimipclltatsvfiiafiaappvdidgirepvs
gsllygnniitgaviptsnaiglhfypiweaasldewlynggpyqlivchfllgvycymg
rewelsfrlgmrpwiavaysapvaaasavflvypigqgsfsdgmplgisgtfnfmivfqa
ehnilmhpfhmlgvagvfggslfsamhgslvtsslirettenesanegyrfgqeeetyni
vaahgyfgrlifqyasfnnsrslhfflaawpvigiwftalglstmafnlngfnfnqsvvd
sqgrvlntwadiinranlgmevmhernahnfpldla

SCOPe Domain Coordinates for d6kaca_:

Click to download the PDB-style file with coordinates for d6kaca_.
(The format of our PDB-style files is described here.)

Timeline for d6kaca_: