SCOPe 2.08: Domain d6kacc_: 6kac C:

Lineage for d6kacc_ (6kac C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [378050] (1 PDB entry)

8. Domain d6kacc_: 6kac C: [378051]
   Other proteins in same PDB: d6kaca_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kacj_, d6kack_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacs_, d6kacy_, d6kacz_
   automated match to d5xnlc_
   complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kacc_

PDB Entry: 6kac, 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d6kacc_:

Sequence; same for both SEQRES and ATOM records:

>d6kacc_ f.55.1.1 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
grdqettgfawwsgnarlinlsgkllgahvahaglivfwagamnlfevshfvpekpmyeq
glillphiatlgygvgpggeiidtfpyfvsgvlhlissavlgfggvyhsligpetleesy
pffgyvwkdknkmtnilgyhlimlglgawllvwkamyfggvydtwapgggdvrvitnptt
naavifgylvkspfggdgwicsvdnmediigghiwigtleilggiwhiyttpwpwarraf
vwsgeaylsyslgaigvmgfiaccmswfnntaypsefygptgpeasqsqaftflvrdqrl
ganvasaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnklkndi
qpwqerraaeymthaplgslnsvggvateinavnfvsprswlacshfclgffffighlwh
agraraaaagfekgidrfdepvlsmrpld

Timeline for d6kacc_:

• d6kacc_ first appeared in SCOPe 2.07