![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
![]() | Protein automated matches [190507] (3 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [377998] (5 PDB entries) |
![]() | Domain d6kacn_: 6kac n: [378014] Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kach_, d6kacj_, d6kack_, d6kacm_, d6kaco_, d6kacp_, d6kacs_, d6kacz_ automated match to d2bhwa_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 6kac (more details), 2.7 Å
SCOPe Domain Sequences for d6kacn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kacn_ f.43.1.1 (n:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} efygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharwam lgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavqvi lmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsmfg ffvqaivtgkgpiqnlddhlsnptvnnafafatkftpsa
Timeline for d6kacn_: