Lineage for d6kacn_ (6kac n:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028375Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 3028388Protein automated matches [190507] (3 species)
    not a true protein
  7. 3028389Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [377998] (5 PDB entries)
  8. 3028396Domain d6kacn_: 6kac n: [378014]
    Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kach_, d6kacj_, d6kack_, d6kacm_, d6kaco_, d6kacp_, d6kacs_, d6kacz_
    automated match to d2bhwa_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kacn_

PDB Entry: 6kac (more details), 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii
PDB Compounds: (n:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d6kacn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kacn_ f.43.1.1 (n:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
efygpnrakwlgpysenatpayltgefpgdygwdtaglsadpetfkryreleliharwam
lgalgcitpellaksgtqfgeavwfkagaqifseggldylgnpslvhaqnivatlavqvi
lmglvegyrvnggpagegldplypgesfdplgladdpdtfaelkvkeikngrlamfsmfg
ffvqaivtgkgpiqnlddhlsnptvnnafafatkftpsa

SCOPe Domain Coordinates for d6kacn_:

Click to download the PDB-style file with coordinates for d6kacn_.
(The format of our PDB-style files is described here.)

Timeline for d6kacn_: