Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.0: automated matches [378000] (1 protein) not a true family |
Protein automated matches [378001] (1 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [378002] (1 PDB entry) |
Domain d6kacj_: 6kac J: [378003] Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kack_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacy_, d6kacz_ automated match to d5v2cj_ complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat |
PDB Entry: 6kac (more details), 2.7 Å
SCOPe Domain Sequences for d6kacj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kacj_ f.23.32.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} tgriplwlvgtvvgtlaigllavffygsyvglgssl
Timeline for d6kacj_: