Lineage for d6kacj_ (6kac J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631818Family f.23.32.0: automated matches [378000] (1 protein)
    not a true family
  6. 2631819Protein automated matches [378001] (1 species)
    not a true protein
  7. 2631820Species Chlamydomonas reinhardtii [TaxId:3055] [378002] (1 PDB entry)
  8. 2631821Domain d6kacj_: 6kac J: [378003]
    Other proteins in same PDB: d6kaca_, d6kacb_, d6kacc_, d6kacd_, d6kace_, d6kacf_, d6kacg_, d6kach_, d6kack_, d6kacm_, d6kacn_, d6kaco_, d6kacp_, d6kacy_, d6kacz_
    automated match to d5v2cj_
    complexed with bcr, bct, chl, cl, cla, dgd, fe2, hem, lhg, lmg, lmu, lut, nex, oex, pho, pl9, sqd, xat

Details for d6kacj_

PDB Entry: 6kac (more details), 2.7 Å

PDB Description: cryo-em structure of the c2s2-type psii-lhcii supercomplex from chlamydomonas reihardtii
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d6kacj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kacj_ f.23.32.0 (J:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
tgriplwlvgtvvgtlaigllavffygsyvglgssl

SCOPe Domain Coordinates for d6kacj_:

Click to download the PDB-style file with coordinates for d6kacj_.
(The format of our PDB-style files is described here.)

Timeline for d6kacj_: