SCOPe 2.07: Domain d6iwmb_: 6iwm B:

Lineage for d6iwmb_ (6iwm B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
   4 helices; folded leaf; right-handed superhelix

4. Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families)
   can be classified as disulfide-rich

5. Family a.52.1.0: automated matches [254196] (1 protein)
   not a true family

6. Protein automated matches [254428] (8 species)
   not a true protein

7. Species Solanum melongena [TaxId:4111] [336505] (5 PDB entries)

8. Domain d6iwmb_: 6iwm B: [377968]
   automated match to d5tviw_
   complexed with gol, so4, trs

Details for d6iwmb_

PDB Entry: 6iwm, 1.98 Å

PDB Description: structural insight into probable lipid transfer mechanism of non- specific lipid transfer protein via intermediate structures in solanum melongena

PDB Compounds: (B:) Non-specific lipid-transfer protein

SCOPe Domain Sequences for d6iwmb_:

Sequence; same for both SEQRES and ATOM records:

>d6iwmb_ a.52.1.0 (B:) automated matches {Solanum melongena [TaxId: 4111]}
vtcgqvdanlapcvpfltqggepgaaccsgvktlngnaqspddrktacncikaaanrypn
lkddaaqslpskcgislnvpisrtincdti

Timeline for d6iwmb_:

• d6iwmb_ is new in SCOPe 2.07-stable
  
• d6iwmb_ appears in the current release, SCOPe 2.08