Lineage for d5vpjh_ (5vpj H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551375Species Actinomadura verrucosospora [TaxId:46165] [377917] (1 PDB entry)
  8. 2551383Domain d5vpjh_: 5vpj H: [377943]
    automated match to d2xflg_
    complexed with cl, pg4

Details for d5vpjh_

PDB Entry: 5vpj (more details), 2.35 Å

PDB Description: the crystal structure of a thioesteras from actinomadura verrucosospora.
PDB Compounds: (H:) thioesterase

SCOPe Domain Sequences for d5vpjh_:

Sequence, based on SEQRES records: (download)

>d5vpjh_ d.38.1.0 (H:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
rayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtssc
sceffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlraed
gltpvevpdelrtaldayap

Sequence, based on observed residues (ATOM records): (download)

>d5vpjh_ d.38.1.0 (H:) automated matches {Actinomadura verrucosospora [TaxId: 46165]}
rayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtssc
sceffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlratp
vevpdelrtaldayap

SCOPe Domain Coordinates for d5vpjh_:

Click to download the PDB-style file with coordinates for d5vpjh_.
(The format of our PDB-style files is described here.)

Timeline for d5vpjh_: