Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (41 species) not a true protein |
Species Actinomadura verrucosospora [TaxId:46165] [377917] (1 PDB entry) |
Domain d5vpjh_: 5vpj H: [377943] automated match to d2xflg_ complexed with cl, pg4 |
PDB Entry: 5vpj (more details), 2.35 Å
SCOPe Domain Sequences for d5vpjh_:
Sequence, based on SEQRES records: (download)
>d5vpjh_ d.38.1.0 (H:) automated matches {Actinomadura verrucosospora [TaxId: 46165]} rayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtssc sceffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlraed gltpvevpdelrtaldayap
>d5vpjh_ d.38.1.0 (H:) automated matches {Actinomadura verrucosospora [TaxId: 46165]} rayfeyrhlvtfadtnlvgnvyftnylswqgacrerflaekapktvarmhddlalvtssc sceffselyaldtvsvrmslvgidfhqitmgfeyyrvtdgparlvargeqtvactlratp vevpdelrtaldayap
Timeline for d5vpjh_: