Lineage for d1et9a2 (1et9 A:96-204)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541634Protein Streptococcal superantigen Spe-H [54350] (1 species)
  7. 2541635Species Streptococcus pyogenes [TaxId:1314] [54351] (2 PDB entries)
  8. 2541636Domain d1et9a2: 1et9 A:96-204 [37793]
    Other proteins in same PDB: d1et9a1

Details for d1et9a2

PDB Entry: 1et9 (more details), 1.9 Å

PDB Description: crystal structure of the superantigen spe-h from streptococcus pyogenes
PDB Compounds: (A:) superantigen spe-h

SCOPe Domain Sequences for d1et9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1et9a2 d.15.6.1 (A:96-204) Streptococcal superantigen Spe-H {Streptococcus pyogenes [TaxId: 1314]}
ekkeikvpvnvwdkskqqppmfitvnkpkvtaqevdikvrkllikkydiynnreqkyskg
tvtldlnsgkdivfdlyyfgngdfnsmlkiysnneridstqfhvdvsis

SCOPe Domain Coordinates for d1et9a2:

Click to download the PDB-style file with coordinates for d1et9a2.
(The format of our PDB-style files is described here.)

Timeline for d1et9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1et9a1