SCOPe 2.08: Domain d1an8a2: 1an8 A:96-208

Lineage for d1an8a2 (1an8 A:96-208)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal superantigen Spe-C [54348] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54349] (3 PDB entries)

8. Domain d1an8a2: 1an8 A:96-208 [37791]
   Other proteins in same PDB: d1an8a1

Details for d1an8a2

PDB Entry: 1an8, 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c

PDB Compounds: (A:) streptococcal pyrogenic exotoxin c

SCOPe Domain Sequences for d1an8a2:

Sequence; same for both SEQRES and ATOM records:

>d1an8a2 d.15.6.1 (A:96-208) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
nkvnhkllgnlfisgesqqnlnnkiilekdivtfqeidfkirkylmdnykiydatspyvs
grieigtkdgkheqidlfdspnegtrsdifakykdnriinmknfshfdiylek

Timeline for d1an8a2:

• d1an8a2 first appeared (with stable ids) in SCOP 1.55, called d1an8_2
  
• d1an8a2 appears in SCOPe 2.07