Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (12 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [319911] (53 PDB entries) |
Domain d6uo4a_: 6uo4 A: [377903] automated match to d5g0ga_ complexed with k, tsn, zn; mutant |
PDB Entry: 6uo4 (more details), 1.27 Å
SCOPe Domain Sequences for d6uo4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uo4a_ c.42.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} atgtglvyvdaftrfhclwdashpecparvstvmemletegllgrcvqvearavtedell lvhtkeyvelmkstqnmteeelktlaekydsvylhpgffssaclsvgsvlqlvdkvmtsq lrngfsinrppghhaqadkmngfcmfnnlaiaaryaqkrhrvqrvlivdwdvhhgqgiqy ifeedpsvlyfsvhryedgsfwphlkesdsssvgsgagqgyninlpwnkvgmesgdyita fqqlllpvayefqpqlvlvaagfdavigdpkggmqvspecfsilthmlkgvaqgrlvlal eggfnlqstaegvcasmrsllgdpcphlpssgapcesalksisktisdlypfwkslq
Timeline for d6uo4a_: