SCOPe 2.07: Domain d6s6yd2: 6s6y D:153-309

Lineage for d6s6yd2 (6s6y D:153-309)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (2 families)
   duplication: contains two subdomains of this fold

5. Family d.58.33.0: automated matches [377821] (1 protein)
   not a true family

6. Protein automated matches [377822] (1 species)
   not a true protein

7. Species Methylobacterium extorquens [TaxId:419610] [377823] (1 PDB entry)

8. Domain d6s6yd2: 6s6y D:153-309 [377825]
   automated match to d1m5sa2
   complexed with ca, cl, dgl, edo, fmt, glu, gol, ias, k, l6k, mfn, na, nh2, zn

Details for d6s6yd2

PDB Entry: 6s6y, 3.1 Å

PDB Description: x-ray crystal structure of the formyltransferase/hydrolase complex (fhcabcd) from methylorubrum extorquens in complex with methylofuran

PDB Compounds: (D:) Formylmethanofuran--tetrahydromethanopterin formyltransferase

SCOPe Domain Sequences for d6s6yd2:

Sequence; same for both SEQRES and ATOM records:

>d6s6yd2 d.58.33.0 (D:153-309) automated matches {Methylobacterium extorquens [TaxId: 419610]}
dgeflcedsvravdgavgggnllflgrkhadtlivaeiaveaakaipgailpfpggivrs
gskvggrtkgmmastndaycptlkgragsalppecgvvleividaltsaavaesmraalh
aateigaqhglvavtagnyggnlgrhhyhlrdllekp

Timeline for d6s6yd2:

• d6s6yd2 is new in SCOPe 2.07-stable
  
• d6s6yd2 appears in the current release, SCOPe 2.08