Lineage for d6o5hb3 (6o5h B:461-610)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338800Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 2338801Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2338802Species Human (Homo sapiens) [TaxId:9606] [63610] (57 PDB entries)
    Uniprot P09960
  8. 2338864Domain d6o5hb3: 6o5h B:461-610 [377762]
    Other proteins in same PDB: d6o5ha1, d6o5ha2, d6o5hb1, d6o5hb2, d6o5hc1, d6o5hc2
    automated match to d3u9wa3
    complexed with lnj, zn

Details for d6o5hb3

PDB Entry: 6o5h (more details), 2.84 Å

PDB Description: the effect of modifier structure on the activation of leukotriene a4 hydrolase aminopeptidase activity.
PDB Compounds: (B:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d6o5hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o5hb3 a.118.1.7 (B:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d6o5hb3:

Click to download the PDB-style file with coordinates for d6o5hb3.
(The format of our PDB-style files is described here.)

Timeline for d6o5hb3: