Lineage for d1se4a2 (1se4 A:122-239)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) 
Domain d1se4a2: 1se4 A:122-239 [37776]
Other proteins in same PDB: d1se4a1
Details for d1se4a2
PDB Entry: 1se4 (more details), 1.9 Å
PDB Description: staphylococcal enterotoxin b complexed with lactose
PDB Compounds: (A:) staphylococcal enterotoxin bSCOPe Domain Sequences for d1se4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se4a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
SCOPe Domain Coordinates for d1se4a2:
Click to download the PDB-style file with coordinates for d1se4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1se4a2:
- d1se4a2 first appeared (with stable ids) in SCOP 1.55, called d1se4_2
- d1se4a2 appears in SCOPe 2.07
View in 3D
