Lineage for d6jbrf_ (6jbr F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518443Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2518444Protein automated matches [190965] (39 species)
    not a true protein
  7. 2518598Species Pyricularia oryzae [TaxId:242507] [377655] (2 PDB entries)
  8. 2518602Domain d6jbrf_: 6jbr F: [377674]
    automated match to d5hvma_
    complexed with t6p, udp

Details for d6jbrf_

PDB Entry: 6jbr (more details), 2.03 Å

PDB Description: tps1/udp/t6p complex
PDB Compounds: (F:) Trehalose-6-phosphate synthase

SCOPe Domain Sequences for d6jbrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jbrf_ c.87.1.0 (F:) automated matches {Pyricularia oryzae [TaxId: 242507]}
rlllisnrlpitikrsddgqysfsmssgglvtglsglakttsfqwygwpglevpdaeagp
vvqrlkneygahpvfvddeladrhyngfansilwplfhyhpgeitfdesawsaykevnrl
faqtvvkdvqdgdmiwvhdyhlmllpemlreeigdskknvkigfflhtpfpsseiyrilp
vrqallqgvlhcdllgfhtydyarhflsscsrilsapttpngvqfagrfvtvgafpigid
pekfveglqkpkvqqriaaltrkfegvklivgvdrldyikgvpqklhalevfltehpewi
gkivlvqvavpsrqdveeyqnlravvnelvgringkfgtiefmpihflhqsvsfdelaal
yavsdvclvsstrdgmnlvsyeyiatqrdrhgvmilseftgaaqslsgslivnpwnteel
anaihdavtmgpeqreanfkkleryvfkytsawwgssfvaelnrl

SCOPe Domain Coordinates for d6jbrf_:

Click to download the PDB-style file with coordinates for d6jbrf_.
(The format of our PDB-style files is described here.)

Timeline for d6jbrf_: