SCOPe 2.07: Domain d6ivyb_: 6ivy B:

Lineage for d6ivyb_ (6ivy B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [196922] (8 PDB entries)

8. Domain d6ivyb_: 6ivy B: [377654]
   automated match to d3wafa_
   complexed with fe, po4

Details for d6ivyb_

PDB Entry: 6ivy, 2 Å

PDB Description: crystal structure of iron-bound hita from pseudomonas aeruginosa

PDB Compounds: (B:) Periplasmic Ferric iron-binding Protein HitA

SCOPe Domain Sequences for d6ivyb_:

Sequence; same for both SEQRES and ATOM records:

>d6ivyb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
pvtltlyngqhaatgiaiakafqdktgiqvkirkggdgqlasqiteegarspadvlytee
spplirlasagllaklepetlalvepehaggngdwigitartrvlaynpkkidekdlpks
lmdlsdpswsgrfgfvptsgafleqvaaviklkgqeeaedwltglkafgsiytnnvtamk
avengevdmalinnyywytlkkekgelnsrlhyfgnqdpgalvtvsgaavlksskhprea
qqfvafmlseegqkailsqsaeypmrkgmqadpalkpfaeldppkltpadlgeasealsl
erdvgln

Timeline for d6ivyb_:

• d6ivyb_ is new in SCOPe 2.07-stable
  
• d6ivyb_ appears in the current release, SCOPe 2.08