Lineage for d6uyqa_ (6uyq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539596Domain d6uyqa_: 6uyq A: [377617]
    automated match to d1y8rc_
    complexed with aly

Details for d6uyqa_

PDB Entry: 6uyq (more details), 1.5 Å

PDB Description: crystal structure of k45-acetylated sumo1 in complex with pml-sim
PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d6uyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uyqa_ d.15.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geyiklkvigqdsseihfkvkmtthlkklkesyaqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqe

SCOPe Domain Coordinates for d6uyqa_:

Click to download the PDB-style file with coordinates for d6uyqa_.
(The format of our PDB-style files is described here.)

Timeline for d6uyqa_: