Lineage for d6ow0a_ (6ow0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2438355Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2438356Protein automated matches [190793] (30 species)
    not a true protein
  7. 2438483Species Streptomyces argillaceus [TaxId:41951] [377442] (3 PDB entries)
  8. 2438488Domain d6ow0a_: 6ow0 A: [377480]
    automated match to d1lqaa_
    complexed with gol, nap, peg

Details for d6ow0a_

PDB Entry: 6ow0 (more details), 2.67 Å

PDB Description: crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg
PDB Compounds: (A:) MtmW

SCOPe Domain Sequences for d6ow0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ow0a_ c.1.7.0 (A:) automated matches {Streptomyces argillaceus [TaxId: 41951]}
mefrslgrsglsvseivygnllypqddtpdevvlssiraaldagvttfdtadvygmfrse
sllgralagtpreelvlctkvgmptgfgpngrglsrkhvmesvdgslrrlrvdhidvyta
hrydpatpleelmwtfsdlvragkilyvgmsewpveriaeaagigarlgvpvichmprys
mlwrapeaevipacrdlgigqicyftleqgvltgkyapgapppagsratapkggraplmr
rwldddkvlgrverlrplaeeaglttaqlalawvlqnpgvsgavigsfnaeqvlanaesa
gvrletdllvridevlgdsvvhd

SCOPe Domain Coordinates for d6ow0a_:

Click to download the PDB-style file with coordinates for d6ow0a_.
(The format of our PDB-style files is described here.)

Timeline for d6ow0a_: