Lineage for d6onuh_ (6onu H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309198Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2309301Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 2309302Protein automated matches [254475] (4 species)
    not a true protein
  7. 2309303Species Mycobacterium tuberculosis [TaxId:83332] [377456] (2 PDB entries)
  8. 2309309Domain d6onuh_: 6onu H: [377462]
    automated match to d1ttya_
    complexed with peg, sf4

Details for d6onuh_

PDB Entry: 6onu (more details), 1.85 Å

PDB Description: complex structure of whib1 and region 4 of siga in p21 space group.
PDB Compounds: (H:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d6onuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6onuh_ a.4.13.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lqdqlqsvldtlsereagvvrlrfgltdgqprtldeigqvygvtrerirqiesktmsklr
hpsrs

SCOPe Domain Coordinates for d6onuh_:

Click to download the PDB-style file with coordinates for d6onuh_.
(The format of our PDB-style files is described here.)

Timeline for d6onuh_: