Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
Protein automated matches [254475] (4 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [377456] (2 PDB entries) |
Domain d6onuh_: 6onu H: [377462] automated match to d1ttya_ complexed with peg, sf4 |
PDB Entry: 6onu (more details), 1.85 Å
SCOPe Domain Sequences for d6onuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6onuh_ a.4.13.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} lqdqlqsvldtlsereagvvrlrfgltdgqprtldeigqvygvtrerirqiesktmsklr hpsrs
Timeline for d6onuh_: