Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein automated matches [226973] (8 species) not a true protein |
Species Escherichia coli [TaxId:562] [359500] (3 PDB entries) |
Domain d6npfa2: 6npf A:140-430 [377435] Other proteins in same PDB: d6npfa1, d6npfa3, d6npfb1, d6npfb3, d6npfc1, d6npfc3, d6npfd1, d6npfd3, d6npfe1, d6npfe3, d6npff1, d6npff3 automated match to d2fymc1 complexed with gol, kvm, mg, so4, tla |
PDB Entry: 6npf (more details), 2.57 Å
SCOPe Domain Sequences for d6npfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6npfa2 c.1.11.1 (A:140-430) automated matches {Escherichia coli [TaxId: 562]} pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq
Timeline for d6npfa2: