Lineage for d6iddc2 (6idd C:323-490)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646489Species Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId:1395981] [377272] (1 PDB entry)
  8. 2646491Domain d6iddc2: 6idd C:323-490 [377356]
    Other proteins in same PDB: d6idda1, d6iddc1, d6idde1, d6iddg1, d6iddi1, d6iddk1
    automated match to d1ha0a2
    complexed with nag; mutant

Details for d6iddc2

PDB Entry: 6idd (more details), 2.38 Å

PDB Description: crystal structure of h7 hemagglutinin mutant sh1-avpl ( s138a, g186v, t221p, q226l) from the influenza virus a/shanghai/1/2013 (h7n9)
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6iddc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iddc2 h.3.1.0 (C:323-490) automated matches {Influenza a virus (a/shanghai/mh01/2013(h7n9)) [TaxId: 1395981]}
lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
qfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqn

SCOPe Domain Coordinates for d6iddc2:

Click to download the PDB-style file with coordinates for d6iddc2.
(The format of our PDB-style files is described here.)

Timeline for d6iddc2: