Lineage for d6jv4c_ (6jv4 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603947Species Vibrio alginolyticus [TaxId:663] [377335] (3 PDB entries)
  8. 2603950Domain d6jv4c_: 6jv4 C: [377347]
    automated match to d5ev8c_
    complexed with cit, zn

Details for d6jv4c_

PDB Entry: 6jv4 (more details), 1.7 Å

PDB Description: crystal structure of metallo-beta-lactamase vmb-1
PDB Compounds: (C:) Metallo-beta-lactamases

SCOPe Domain Sequences for d6jv4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jv4c_ d.157.1.0 (C:) automated matches {Vibrio alginolyticus [TaxId: 663]}
gtkelklkklsdnvyqhisykrvepwgligasglvvingteahmidtpwttqgtkqliew
ieakgltiksavvthfhedasgdipllndlkiktyatsltnkllklnqkevssdeissnt
fefidgvasvfypgaghtednivvwlpnekilfggcfvkslknknlgytgdanisewpns
mqkvinrypdaklvvpghgevgdvsllkhtqalalsaaas

SCOPe Domain Coordinates for d6jv4c_:

Click to download the PDB-style file with coordinates for d6jv4c_.
(The format of our PDB-style files is described here.)

Timeline for d6jv4c_: