SCOPe 2.07: Domain d6uxed1: 6uxe D:35-159

Lineage for d6uxed1 (6uxe D:35-159)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein automated matches [254586] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [341681] (5 PDB entries)

8. Domain d6uxed1: 6uxe D:35-159 [377182]
   Other proteins in same PDB: d6uxea1, d6uxea2, d6uxec_, d6uxed2
   automated match to d2l4xa_
   complexed with 1pe, 8q1, dtt, edo, edt, gol, mes, p15, peg, pg4, pge, plp

Details for d6uxed1

PDB Entry: 6uxe, 1.57 Å

PDB Description: structure of the human mitochondrial desulfurase complex nfs1- iscu2(m140i)-isd11 with e.coli acp1 at 1.57 a resolution showing flexibility of n terminal end of iscu2

PDB Compounds: (D:) Iron-sulfur cluster assembly enzyme ISCU, mitochondrial

SCOPe Domain Sequences for d6uxed1:

Sequence; same for both SEQRES and ATOM records:

>d6uxed1 d.224.1.2 (D:35-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yhkkvvdhyenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfg
cgsaiassslatewvkgktveealtikntdiakelclppvklhcsilaedaikaaladyk
lkqep

Timeline for d6uxed1:

• d6uxed1 is new in SCOPe 2.07-stable
  
• d6uxed1 appears in the current release, SCOPe 2.08