SCOPe 2.07: Domain d6nfnm1: 6nfn M:3-110

Lineage for d6nfnm1 (6nfn M:3-110)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

Domain d6nfnm1: 6nfn M:3-110 [377104]
Other proteins in same PDB: d6nfna2, d6nfnc2, d6nfne2, d6nfni2, d6nfnl2, d6nfnm2, d6nfno2, d6nfnq2
automated match to d1aqkl1
complexed with act, bcg, fmt, gol, peg

Details for d6nfnm1

PDB Entry: 6nfn (more details), 2.63 Å

PDB Description: fab fragment of anti-cocaine antibody h2e2 bound to benzoylecgonine

PDB Compounds: (M:) Fab h2E2 light chain

SCOPe Domain Sequences for d6nfnm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nfnm1 b.1.1.0 (M:3-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vviqesalttspggtviltcrsstgtittsnyanwvqkkpnhvftgligatsirapgvpv
rfsgfliggkaaltitgaqteddamyfcalwynthyvfgggtkvtvlg

SCOPe Domain Coordinates for d6nfnm1:

Click to download the PDB-style file with coordinates for d6nfnm1.
(The format of our PDB-style files is described here.)

Timeline for d6nfnm1: