Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Cryptococcus neoformans [TaxId:1230076] [376374] (6 PDB entries) |
Domain d6isja_: 6isj A: [377049] automated match to d3at3a_ complexed with 3ng, so4 |
PDB Entry: 6isj (more details), 2.3 Å
SCOPe Domain Sequences for d6isja_:
Sequence, based on SEQRES records: (download)
>d6isja_ d.144.1.7 (A:) automated matches {Cryptococcus neoformans [TaxId: 1230076]} svarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlptdskci vkvlkpvkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntefktlyp kfsdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaefyhpgt eynvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadqlvkia kvlgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfldkllr ydhqerltaeeakehpyfepvrqaaa
>d6isja_ d.144.1.7 (A:) automated matches {Cryptococcus neoformans [TaxId: 1230076]} svarvyanvneklgrswwdydnlvvqwgvqdnyeivrkvgrgkysevfesihlptdskci vkvlkkkkkikreikilqnlaggpnvvglldvvrdsqsktpsivteyvnntefktlypkf sdfdvryyifellkaldfchskgimhrdvkphnvmidhekrtlrlidwglaefyhpgtey nvrvasryfkgpellvdfqeydysldmwslgcmfasmifrkepffhghdnadqlvkiakv lgtdelytylerydidldaqfddilgryprkpwsrfvssenqryisseaidfldkllryd hqerltaeeakehpyfepvrqaaa
Timeline for d6isja_: