Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d6i3zl2: 6i3z L:108-214 [377038] Other proteins in same PDB: d6i3zl1 automated match to d1h3pl2 complexed with na, so4 |
PDB Entry: 6i3z (more details), 3.1 Å
SCOPe Domain Sequences for d6i3zl2:
Sequence, based on SEQRES records: (download)
>d6i3zl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d6i3zl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgsegvlnswtdqdskd stysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d6i3zl2: