Lineage for d1ffua2 (1ffu A:3-81)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598835Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) (S)
  5. 598929Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (12 proteins)
  6. 598946Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 598947Species Hydrogenophaga pseudoflava [TaxId:47421] [54322] (2 PDB entries)
  8. 598950Domain d1ffua2: 1ffu A:3-81 [37702]
    Other proteins in same PDB: d1ffua1, d1ffub1, d1ffub2, d1ffuc1, d1ffuc2, d1ffud1, d1ffue1, d1ffue2, d1ffuf1, d1ffuf2

Details for d1ffua2

PDB Entry: 1ffu (more details), 2.35 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor

SCOP Domain Sequences for d1ffua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffua2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava}
kkiitvnvngkaqekaveprtllihflreelnltgahigcetshcgactvdidgrsvksc
thlavqcdgsevltvegla

SCOP Domain Coordinates for d1ffua2:

Click to download the PDB-style file with coordinates for d1ffua2.
(The format of our PDB-style files is described here.)

Timeline for d1ffua2: