SCOPe 2.07: Domain d6ugsb2: 6ugs B:107-214

Lineage for d6ugsb2 (6ugs B:107-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6ugsb2: 6ugs B:107-214 [376978]
   Other proteins in same PDB: d6ugsb1, d6ugsl1
   automated match to d1dn0a2

Details for d6ugsb2

PDB Entry: 6ugs, 1.95 Å

PDB Description: crystal structure of the fab fragment of pf06438179/gp1111 an infliximab biosimilar in a c-centered orthorhombic crystal form, lot a

PDB Compounds: (B:) Infliximab (Remicade) Fab Light Chain

SCOPe Domain Sequences for d6ugsb2:

Sequence; same for both SEQRES and ATOM records:

>d6ugsb2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d6ugsb2:

• d6ugsb2 is new in SCOPe 2.07-stable
  
• d6ugsb2 appears in the current release, SCOPe 2.08