SCOPe 2.07: Domain d6ugub1: 6ugu B:1-106

Lineage for d6ugub1 (6ugu B:1-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6ugub1: 6ugu B:1-106 [376946]
   Other proteins in same PDB: d6ugub2, d6ugul2
   automated match to d1dn0a1

Details for d6ugub1

PDB Entry: 6ugu, 2.2 Å

PDB Description: crystal structure of the fab fragment of anti-tnfa antibody infliximab (remicade) in a c-centered orthorhombic crystal form, lot c

PDB Compounds: (B:) PF06438179 Fab Light Chain

SCOPe Domain Sequences for d6ugub1:

Sequence; same for both SEQRES and ATOM records:

>d6ugub1 b.1.1.0 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dilltqspailsvspgervsfscrasqfvgssihwyqqrtngsprllikyasesmsgips
rfsgsgsgtdftlsintvesediadyycqqshswpftfgsgtnlev

Timeline for d6ugub1:

• d6ugub1 is new in SCOPe 2.07-stable
  
• d6ugub1 appears in the current release, SCOPe 2.08