Lineage for d6ueec_ (6uee C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423278Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423279Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2423626Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2423627Protein automated matches [190967] (35 species)
    not a true protein
  7. 2423774Species Pseudomonas aeruginosa [TaxId:381754] [276926] (5 PDB entries)
  8. 2423789Domain d6ueec_: 6uee C: [376941]
    automated match to d5depa_
    complexed with gol, q5m

Details for d6ueec_

PDB Entry: 6uee (more details), 2.1 Å

PDB Description: pseudomonas aeruginosa lpxa complex structure with ligand
PDB Compounds: (C:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d6ueec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ueec_ b.81.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]}
lidpraiidpsarlaadvqvgpwsivgaeveigegtvigphvvlkgptkigkhnriyqfs
svgedtpdlkykgeptrlvigdhnviregvtihrgtvqdraettigdhnlimayahighd
svignhcilvnntalaghvhvddwailsgytlvhqycrigahsfsgmgsaigkdvpayvt
vfgnpaearsmnfegmrrrgfsseaihalrraykvvyrqghtveealaelaesaaqfpev
avfrdsiqsatrgitr

SCOPe Domain Coordinates for d6ueec_:

Click to download the PDB-style file with coordinates for d6ueec_.
(The format of our PDB-style files is described here.)

Timeline for d6ueec_: