Class b: All beta proteins [48724] (178 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries) |
Domain d6u7fb1: 6u7f B:66-287 [376913] Other proteins in same PDB: d6u7fa2, d6u7fa3, d6u7fa4, d6u7fb2, d6u7fb3, d6u7fb4 automated match to d4fyqa1 complexed with nag, zn |
PDB Entry: 6u7f (more details), 2.75 Å
SCOPe Domain Sequences for d6u7fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u7fb1 b.98.1.0 (B:66-287) automated matches {Human (Homo sapiens) [TaxId: 9606]} dqskawnryrlpntlkpdsyrvtlrpyltpndrglyvfkgsstvrftckeatdviiihsk klnytlsqghrvvlrgvggsqppdidktelvepteylvvhlkgslvkdsqyemdsefege laddlagfyrseymegnvrkvvattqmqaadarksfpcfdepamkaefnitlihpkdlta lsnmlpkgpstplpedpnwnvtefhttpkmstyllafivsef
Timeline for d6u7fb1:
View in 3D Domains from other chains: (mouse over for more information) d6u7fa1, d6u7fa2, d6u7fa3, d6u7fa4 |