Lineage for d6rnnc2 (6rnn C:112-216)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370053Domain d6rnnc2: 6rnn C:112-216 [376902]
    automated match to d5fhxl3

Details for d6rnnc2

PDB Entry: 6rnn (more details), 1.74 Å

PDB Description: p46, an immunodominant surface protein from mycoplasma hyopneumoniae
PDB Compounds: (C:) immunoglobulin light chain

SCOPe Domain Sequences for d6rnnc2:

Sequence, based on SEQRES records: (download)

>d6rnnc2 b.1.1.0 (C:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records): (download)

>d6rnnc2 b.1.1.0 (C:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceatspivksfnrn

SCOPe Domain Coordinates for d6rnnc2:

Click to download the PDB-style file with coordinates for d6rnnc2.
(The format of our PDB-style files is described here.)

Timeline for d6rnnc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rnnc1