Lineage for d1qobb_ (1qob B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638762Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1638763Protein 2Fe-2S ferredoxin [54294] (17 species)
  7. 1638764Species Anabaena sp., pcc 7119 and 7120 [TaxId:1167] [54295] (12 PDB entries)
  8. 1638776Domain d1qobb_: 1qob B: [37656]
    complexed with fes, so4; mutant

Details for d1qobb_

PDB Entry: 1qob (more details), 1.8 Å

PDB Description: ferredoxin mutation d62k
PDB Compounds: (B:) ferredoxin

SCOPe Domain Sequences for d1qobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qobb_ d.15.4.1 (B:) 2Fe-2S ferredoxin {Anabaena sp., pcc 7119 and 7120 [TaxId: 1167]}
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
skqsfldddqieagyvltcvayptsdvviqthkeedly

SCOPe Domain Coordinates for d1qobb_:

Click to download the PDB-style file with coordinates for d1qobb_.
(The format of our PDB-style files is described here.)

Timeline for d1qobb_: