Lineage for d6mycf_ (6myc F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547822Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2547984Domain d6mycf_: 6myc F: [376488]
    automated match to d1xssb_

Details for d6mycf_

PDB Entry: 6myc (more details), 2.4 Å

PDB Description: room-temperature structure of deuterated tetdron (isomorph 2)
PDB Compounds: (F:) Fluorescent protein Padron0.9

SCOPe Domain Sequences for d6mycf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mycf_ d.22.1.0 (F:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydiltmaf
cygnrvfakypenivdyfkqsfpegyswersmiyedggicnatnditldgdcyiceirfd
gvnfpangpvmqkrtvkwelsteklyvrdgvlksdgnyalsleggghyrcdfkttykakk
vvqlpdyhsvdhhieiishdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d6mycf_:

Click to download the PDB-style file with coordinates for d6mycf_.
(The format of our PDB-style files is described here.)

Timeline for d6mycf_: