SCOPe 2.07: Domain d6mekg2: 6mek G:109-209

Lineage for d6mekg2 (6mek G:109-209)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6mekg2: 6mek G:109-209 [376414]
   Other proteins in same PDB: d6mekd1, d6meke1, d6mekg1, d6mekl1
   automated match to d1aqkl2
   complexed with bma, man, nag

Details for d6mekg2

PDB Entry: 6mek, 3.1 Å

PDB Description: crystal structure of hepatitis c virus envelope glycoprotein e2 core in complex with human antibodies hepc3 and hepc46

PDB Compounds: (G:) HEPC46 Light Chain

SCOPe Domain Sequences for d6mekg2:

Sequence; same for both SEQRES and ATOM records:

>d6mekg2 b.1.1.2 (G:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d6mekg2:

• d6mekg2 is new in SCOPe 2.07-stable
  
• d6mekg2 appears in the current release, SCOPe 2.08