Lineage for d6u7ib3 (6u7i B:286-597)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441379Species Faecalibacterium prausnitzii [TaxId:853] [376260] (1 PDB entry)
  8. 2441381Domain d6u7ib3: 6u7i B:286-597 [376322]
    Other proteins in same PDB: d6u7ia1, d6u7ia2, d6u7ib1, d6u7ib2, d6u7ic1, d6u7ic2, d6u7id1, d6u7id2
    automated match to d3hn3a3

Details for d6u7ib3

PDB Entry: 6u7i (more details), 2.7 Å

PDB Description: faecalibacterium prausnitzii beta-glucuronidase
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6u7ib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u7ib3 c.1.8.0 (B:286-597) automated matches {Faecalibacterium prausnitzii [TaxId: 853]}
ievrgtqvllngkplyfkgfckhedftahgrgfdpvlnvkdvnlihwananavrtshypy
aeefydlcdregilvmdetpavgigggaavnpykeyplaehhrqvlaemihrdknhpcvv
lwslgnepnlehfpqdaydywhplyelahqldpqdrpvtlvccqndytkdittrtmdivc
inryygwynlsgdmdaacyglnqeldfwaeqhkpvmmseygadtvaglhtagaemfseef
qvefyrrldaefdkrpwfvgefvwnfadydtvqgpmrvdgnkkglftrdrrpklgmhflr
qrwaeiptfgfk

SCOPe Domain Coordinates for d6u7ib3:

Click to download the PDB-style file with coordinates for d6u7ib3.
(The format of our PDB-style files is described here.)

Timeline for d6u7ib3: