Lineage for d6ur3a_ (6ur3 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620536Species Pseudomonas aeruginosa [TaxId:287] [189201] (31 PDB entries)
  8. 2620553Domain d6ur3a_: 6ur3 A: [376305]
    automated match to d4gzba_
    complexed with cl, edo, qfp

Details for d6ur3a_

PDB Entry: 6ur3 (more details), 1.42 Å

PDB Description: serendipitous discovery of aryl boronic acids as beta-lactamase inhibitors
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6ur3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ur3a_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
geapadrlkalvdaavqpvmkandipglavaislkgephyfsyglaskedgrrvtpetlf
eigsvsktftatlagyaltqdkmrlddrasqhwpalqgsrfdgislldlatytagglplq
fpdsvqkdqaqirdyyrqwqptyapgsqrlysnpsiglfgylaarslgqpferlmeqqvf
palgleqthldvpeaalaqyaqgygkddrplrvgpgpldaegygvktsaadllrfvdanl
hperldrpwaqaldathrgyykvgdmtqglgweaydwpislkrlqagnstpmalqphria
rlpapqalegqrllnktgstngfgayvafvpgrdlglvilanrnypnaervkiayailsg
leq

SCOPe Domain Coordinates for d6ur3a_:

Click to download the PDB-style file with coordinates for d6ur3a_.
(The format of our PDB-style files is described here.)

Timeline for d6ur3a_: