Lineage for d6ryga_ (6ryg A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607746Species Bos taurus [TaxId:9913] [374004] (7 PDB entries)
  8. 2607747Domain d6ryga_: 6ryg A: [375862]
    automated match to d4dn8a1
    complexed with ca

Details for d6ryga_

PDB Entry: 6ryg (more details), 0.97 Å

PDB Description: native structure of conglutinin carbohydrate recognition domain
PDB Compounds: (A:) Conglutinin

SCOPe Domain Sequences for d6ryga_:

Sequence, based on SEQRES records: (download)

>d6ryga_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm
ndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcskqllvic
ef

Sequence, based on observed residues (ATOM records): (download)

>d6ryga_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]}
dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm
ndistegrftyptgeilvysnwadgepnpencveifpdgkwndvpcskqllvicef

SCOPe Domain Coordinates for d6ryga_:

Click to download the PDB-style file with coordinates for d6ryga_.
(The format of our PDB-style files is described here.)

Timeline for d6ryga_: