Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Bos taurus [TaxId:9913] [374004] (7 PDB entries) |
Domain d6ryga_: 6ryg A: [375862] automated match to d4dn8a1 complexed with ca |
PDB Entry: 6ryg (more details), 0.97 Å
SCOPe Domain Sequences for d6ryga_:
Sequence, based on SEQRES records: (download)
>d6ryga_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]} dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm ndistegrftyptgeilvysnwadgepnnsdegqpencveifpdgkwndvpcskqllvic ef
>d6ryga_ d.169.1.1 (A:) automated matches {Bos taurus [TaxId: 9913]} dgqavgekifktagavksysdaeqlcreakgqlasprssaeneavtqmvraqeknaylsm ndistegrftyptgeilvysnwadgepnpencveifpdgkwndvpcskqllvicef
Timeline for d6ryga_: