Lineage for d6ocwv_ (6ocw V:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2601868Species Mycobacterium tuberculosis [TaxId:83332] [375714] (3 PDB entries)
  8. 2601890Domain d6ocwv_: 6ocw V: [375744]
    automated match to d3krdr_
    complexed with cit, dmf, m6m

Details for d6ocwv_

PDB Entry: 6ocw (more details), 2.6 Å

PDB Description: crystal structure of mycobacterium tuberculosis proteasome in complex with phenylimidazole-based inhibitor a85
PDB Compounds: (V:) Proteasome subunit beta

SCOPe Domain Sequences for d6ocwv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ocwv_ d.153.1.4 (V:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrsg

SCOPe Domain Coordinates for d6ocwv_:

Click to download the PDB-style file with coordinates for d6ocwv_.
(The format of our PDB-style files is described here.)

Timeline for d6ocwv_: