SCOPe 2.07: Domain d6o1fi_: 6o1f I:

Lineage for d6o1fi_ (6o1f I:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
   automatically mapped to Pfam PF00197

6. Protein automated matches [190504] (3 species)
   not a true protein

7. Species Glycine max [TaxId:3847] [375712] (1 PDB entry)

8. Domain d6o1fi_: 6o1f I: [375713]
   Other proteins in same PDB: d6o1fa_, d6o1fl1, d6o1fl2
   automated match to d1avwb_
   complexed with edo

Details for d6o1fi_

PDB Entry: 6o1f, 2.15 Å

PDB Description: complex between soybean trypsin inhibitor beta1-tryptase and a humanized fab

PDB Compounds: (I:) trypsin inhibitor a

SCOPe Domain Sequences for d6o1fi_:

Sequence; same for both SEQRES and ATOM records:

>d6o1fi_ b.42.4.1 (I:) automated matches {Glycine max [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkld

Timeline for d6o1fi_:

• d6o1fi_ is new in SCOPe 2.07-stable
  
• d6o1fi_ appears in the current release, SCOPe 2.08