SCOPe 2.07: Domain d6n5jb2: 6n5j B:285-495

Lineage for d6n5jb2 (6n5j B:285-495)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein automated matches [190304] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [356353] (9 PDB entries)

8. Domain d6n5jb2: 6n5j B:285-495 [375700]
   Other proteins in same PDB: d6n5ja1, d6n5ja3, d6n5jb1, d6n5jb3
   automated match to d2qy9a2
   complexed with act, nh4

Details for d6n5jb2

PDB Entry: 6n5j, 1.37 Å

PDB Description: ftsy-ng high-resolution

PDB Compounds: (B:) signal recognition particle receptor ftsy

SCOPe Domain Sequences for d6n5jb2:

Sequence; same for both SEQRES and ATOM records:

>d6n5jb2 c.37.1.10 (B:285-495) automated matches {Escherichia coli [TaxId: 83333]}
plnvegkapfvilmvgvngvgktttigklarqfeqqgksvmlaagdtfraaaveqlqvwg
qrnnipviaqhtgadsasvifdaiqaakarnidvliadtagrlqnkshlmeelkkivrvm
kkldveaphevmltidastgqnavsqaklfheavgltgitltkldgtakggvifsvadqf
gipiryigvgeriedlrpfkaddfiealfar

Timeline for d6n5jb2:

• d6n5jb2 is new in SCOPe 2.07-stable
  
• d6n5jb2 appears in the current release, SCOPe 2.08