Lineage for d6mlba_ (6mlb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414734Protein automated matches [190295] (7 species)
    not a true protein
  7. 2414754Species Human (Homo sapiens) [TaxId:9606] [187133] (101 PDB entries)
  8. 2414917Domain d6mlba_: 6mlb A: [375665]
    automated match to d5fazb_
    complexed with act, gol, ret; mutant

Details for d6mlba_

PDB Entry: 6mlb (more details), 2.15 Å

PDB Description: crystal structure of the holo retinal-bound domain-swapped dimer q108k:k40l:t51f mutant of human cellular retinol binding protein ii
PDB Compounds: (A:) Retinol-binding protein 2

SCOPe Domain Sequences for d6mlba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mlba_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfkfkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

SCOPe Domain Coordinates for d6mlba_:

Click to download the PDB-style file with coordinates for d6mlba_.
(The format of our PDB-style files is described here.)

Timeline for d6mlba_: