SCOPe 2.07: Domain d6myrb1: 6myr B:8-114

Lineage for d6myrb1 (6myr B:8-114)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein automated matches [231466] (5 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [375655] (7 PDB entries)

8. Domain d6myrb1: 6myr B:8-114 [375656]
   Other proteins in same PDB: d6myrb2, d6myrd_
   automated match to d2h89b1
   complexed with 3pe, bog, f3s, fad, fes, hem, k, k7g, oaa, peg, sf4, umq, unl

Details for d6myrb1

PDB Entry: 6myr, 2.15 Å

PDB Description: avian mitochondrial complex ii with thiapronil bound

PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d6myrb1:

Sequence; same for both SEQRES and ATOM records:

>d6myrb1 d.15.4.2 (B:8-114) automated matches {Gallus gallus [TaxId: 9031]}
tsrikkfsiyrwdpdkpgdkprmqtyevdlnkcgpmvldalikikneldstltfrrscre
gicgscamniaggntlactkkidpdlskttkiyplphmyvvkdlvpd

Timeline for d6myrb1:

• d6myrb1 is new in SCOPe 2.07-stable
  
• d6myrb1 appears in the current release, SCOPe 2.08