SCOPe 2.07: Domain d6ijxa_: 6ijx A:

Lineage for d6ijxa_ (6ijx A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188399] (47 PDB entries)

8. Domain d6ijxa_: 6ijx A: [375629]
   automated match to d2fgba_
   complexed with jms, nap

Details for d6ijxa_

PDB Entry: 6ijx, 2.2 Å

PDB Description: crystal structure of akr1c1 complexed with meclofenamic acid

PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d6ijxa_:

Sequence; same for both SEQRES and ATOM records:

>d6ijxa_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvsvkpg
eevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnvry
ltldifagppnypfsdey

Timeline for d6ijxa_:

• d6ijxa_ is new in SCOPe 2.07-stable
  
• d6ijxa_ appears in the current release, SCOPe 2.08