SCOPe 2.08: Domain d1hnzi_: 1hnz I:

Lineage for d1hnzi_ (1hnz I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (5 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
   Uniprot P80374

8. Domain d1hnzi_: 1hnz I: [37561]
   Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
   complexed with hyg, mg, zn

Details for d1hnzi_

PDB Entry: 1hnz, 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d1hnzi_:

Sequence; same for both SEQRES and ATOM records:

>d1hnzi_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d1hnzi_:

• d1hnzi_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnzi_ appears in SCOPe 2.07