SCOPe 2.08: Domain d6jljl_: 6jlj l:

Lineage for d6jljl_ (6jlj l:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family)
   automatically mapped to Pfam PF02419

5. Family f.23.31.1: PsbL-like [161018] (2 proteins)
   Pfam PF02419

6. Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)

8. Domain d6jljl_: 6jlj l: [375543]
   Other proteins in same PDB: d6jlja_, d6jljb_, d6jljc_, d6jljd_, d6jlje_, d6jljf_, d6jljh_, d6jlji_, d6jljj_, d6jljk_, d6jljm_, d6jljo_, d6jljt_, d6jlju_, d6jljv_, d6jljx_, d6jljz_
   automated match to d5tisl_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d6jljl_

PDB Entry: 6jlj, 2.15 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (dark state, dataset1)

PDB Compounds: (l:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d6jljl_:

Sequence; same for both SEQRES and ATOM records:

>d6jljl_ f.23.31.1 (l:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

Timeline for d6jljl_:

• d6jljl_ first appeared in SCOPe 2.07