Lineage for d6k2nb_ (6k2n B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390941Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries)
  8. 2390950Domain d6k2nb_: 6k2n B: [375541]
    automated match to d5jdba_
    complexed with a2g, gal, nag

Details for d6k2nb_

PDB Entry: 6k2n (more details), 1.8 Å

PDB Description: structural basis of glycan recognition in globally predominant human p[8] rotavirus
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d6k2nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k2nb_ b.29.1.0 (B:) automated matches {Rotavirus a [TaxId: 28875]}
ildgpyqpttftppidywilinsntngvvyestnnsdfwtavvaiephvnpvdrqytvfg
enkqfnvrndsdkwkflemfrsssqnefynrrtltsdtklvgilkyggriwtfhgetpra
ttdssntanlndisiiihsefyiiprsqeskcneyinngl

SCOPe Domain Coordinates for d6k2nb_:

Click to download the PDB-style file with coordinates for d6k2nb_.
(The format of our PDB-style files is described here.)

Timeline for d6k2nb_: