Lineage for d6jloz_ (6jlo z:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629297Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 2629660Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 2629661Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 2629662Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 2629673Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 2629698Domain d6jloz_: 6jlo z: [375504]
    Other proteins in same PDB: d6jloa_, d6jlob_, d6jloc_, d6jlod_, d6jloe_, d6jlof_, d6jloh_, d6jloi_, d6jloj_, d6jlok_, d6jlol_, d6jlom_, d6jloo_, d6jlot_, d6jlou_, d6jlov_, d6jlox_
    automated match to d3a0hz_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d6jloz_

PDB Entry: 6jlo (more details), 2.4 Å

PDB Description: xfel structure of cyanobacterial photosystem ii (2f state, dataset2)
PDB Compounds: (z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d6jloz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jloz_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d6jloz_:

Click to download the PDB-style file with coordinates for d6jloz_.
(The format of our PDB-style files is described here.)

Timeline for d6jloz_: